DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG34303

DIOPT Version :10

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001356898.1 Gene:CG34303 / 5740723 FlyBaseID:FBgn0085332 Length:181 Species:Drosophila melanogaster


Alignment Length:193 Identity:47/193 - (24%)
Similarity:84/193 - (43%) Gaps:35/193 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRFIIIRVFC-TITLSLEINGESITRHTNVKCEVLDKSFAEFPVCKLNVLGR--GIIAESVYMKF 62
            :|...:.:|| .|.:..:::|.  .:..::.|||:.....:..:|::..:.|  .:|..|.   |
  Fly     4 VRVAFLCIFCFNIFVISKVHGS--YKFNSLACEVMAPELGKMKLCEIKAIDRKHNMINLSA---F 63

  Fly    63 LKLPIKKISVNFTVYKK-LSGYHPFLFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPY 126
            |...|.::.::|.:.|: ..|:|||.:::.:|.|.:.|:.....|.:..|:.:|||:|.||:|||
  Fly    64 LNKTISEVEIHFKMVKRERGGWHPFFYDIRIDVCQFFKNRRGFFISNLIYSFIKPYTNVNHTCPY 128

  Fly   127 ---------NVSESYHDILVKDFVLTDTMFAKIPLPTGNYMFSIKLATDDVWRVVLNTYFDVN 180
                     |.|..           .|.:.||.|:..|.|      .....|.|.......||
  Fly   129 MEGTEMRLWNWSPD-----------EDAVLAKFPVDHGTY------GLQTTWYVKKEAALKVN 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:461928 28/96 (29%)
CG34303NP_001356898.1 DUF1091 73..157 CDD:461928 27/94 (29%)

Return to query results.
Submit another query.