DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG14518

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:155 Identity:46/155 - (29%)
Similarity:75/155 - (48%) Gaps:8/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKLSGYHPFL 87
            |.:.||..||..:||:.||.:|:|..:.|..:..:|....|. |:..:.|...:.|:.:||.|:|
  Fly    24 IFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH-PVHDVIVKARLLKRANGYKPWL 87

  Fly    88 FNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVKDFVLTDTMFAKIPL 152
            ::|:.|.|.:::..|.. :....:...|.||..||:|||...:.     ||:|.|..... ..|:
  Fly    88 YSVSFDGCQFIRRRNNA-LIRIVWELFKEYSTINHTCPYVGLQQ-----VKNFYLRSEKL-PTPI 145

  Fly   153 PTGNYMFSIKLATDDVWRVVLNTYF 177
            |||.|:..|....:...:...|.||
  Fly   146 PTGEYLLMIDWVFNKKPQAATNVYF 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 27/86 (31%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 28/95 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472530
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.890

Return to query results.
Submit another query.