DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG13250

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:159 Identity:35/159 - (22%)
Similarity:63/159 - (39%) Gaps:25/159 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RHTNVKCEVLDKSFAEFPVCKL--------NVLGRG-IIAESVYMKFLKLPIKKISVNFTVYKKL 80
            |..::.|.|:|.:.||...|.:        |.|... ::..||...:::|.:.:|:      .:.
  Fly    34 RWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRSVTKMWVELSVGQIA------NRK 92

  Fly    81 SGYHPFLFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVKDFVLTDT 145
            ......||.:.||.||.::..:...|.:.....:....|:..:||...:.:|          |.|
  Fly    93 DRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDACPLLANVNY----------TST 147

  Fly   146 MFAKIPLPTGNYMFSIKLATDDVWRVVLN 174
            .||..|.....||..:|..|..|:::..|
  Fly   148 RFALNPDHFPAYMPDMKFNTKLVFQLSRN 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 17/86 (20%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 22/92 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472650
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.