DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33632

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:161 Identity:68/161 - (42%)
Similarity:93/161 - (57%) Gaps:12/161 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKLSGYHPF 86
            |:...|||:||.|||.|:.|..|.|..:.|.....|:.:|.||:|:.||.|.|.:||:|:||.||
  Fly    24 SLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQFGLYKRLNGYKPF 88

  Fly    87 LFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYN----VSE-SYHDILVKDFVLTDTM 146
            |:|:|:|.|.::|..||..|..|||...|.|||.||:||||    :.| |||.|   ::.||:. 
  Fly    89 LYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEMSYHSI---NYKLTEI- 149

  Fly   147 FAKIPLPTGNYMFSIKLATDDVWRVVLNTYF 177
               :|.|.|||...:.....|:.|.:...||
  Fly   150 ---LPFPEGNYKLEVHWIAYDIDRAITTFYF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 43/91 (47%)
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 43/91 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472232
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.