DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG13561

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:143 Identity:39/143 - (27%)
Similarity:71/143 - (49%) Gaps:10/143 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LEINGESITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKL 80
            |::.|  :.:.||::|...|::|....:|:|..:.|.::..|:....|:.|...:|:...:.||.
  Fly    17 LQVQG--VAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMRMQLLKKA 79

  Fly    81 SGYHPFLFNV-TVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVKDFVLTD 144
            |||.|||:|: ..|.|.|::..|     |.|...:  .|:|.:....|......:|:::.|....
  Fly    80 SGYKPFLYNICQSDVCEYLEKRN-----HPFINII--LSSFGNRTNVNKCPIPPEIVLEHFRFPV 137

  Fly   145 TMFAKIPLPTGNY 157
            .:...:|||.|:|
  Fly   138 KVLDMMPLPFGDY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 25/87 (29%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 21/76 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472529
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.