DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33679

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster


Alignment Length:174 Identity:83/174 - (47%)
Similarity:120/174 - (68%) Gaps:12/174 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSLEINGES--ITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTV 76
            :||...|||  ..|.||:|||..||||..||.|:|.|||||||..::::|.|||||.::.|.|..
  Fly     7 ISLLFIGESHGYVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVVRFIT 71

  Fly    77 YKKLSGYHPFLFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVKDFV 141
            |:||:|||||||||:.:.|..:::||.:.:|:|||||..|:||.||:||||     .||.:::..
  Fly    72 YRKLNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYN-----DDIYIRNCT 131

  Fly   142 LTDTMFAKIPLPTGNYMFSIKLATDD---VWRVVLNTYFDVNVE 182
            |.|.||||:|||.|:|..::::  ||   .|..::|.:|:::|:
  Fly   132 LDDRMFAKVPLPKGSYKLTLEM--DDGVVNWISIINIHFEIDVD 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 45/86 (52%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 43/83 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471964
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.