DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33771

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster


Alignment Length:101 Identity:23/101 - (22%)
Similarity:45/101 - (44%) Gaps:15/101 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LKLPIKK-ISVNFTVYKKLSGYHPF--LFNVTVDFC---HYMKHPNPMNIFHYFYTAVKPYSNFN 121
            |..||:: ...:..:..:|:....|  :|:...|.|   ..:|:    ::|..::..:...|||.
  Fly    57 LNRPIQRGFKAHVDILLRLANAKNFQSMFSQKSDVCAVTSSVKN----SLFKSWFKDMSKNSNFM 117

  Fly   122 HSCPYNVSESYHDILVKDFVLTDTMFAKIPLPTGNY 157
            ::||..|...|    :.|:.:..:|..|..:| |.|
  Fly   118 YNCPVEVGHYY----MHDWRMGSSMTHKFLIP-GEY 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 20/91 (22%)
CG33771NP_001027145.3 DM8 80..171 CDD:214778 19/78 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447907
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.