DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33928

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster


Alignment Length:157 Identity:57/157 - (36%)
Similarity:84/157 - (53%) Gaps:15/157 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKLSGYHPFLFNVT 91
            ||:||..:||.|::|..|.|....|.....||.::..|:|:...:||..::|:.:|..||..|.|
  Fly    30 TNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTVNLGLHKRSNGLMPFNQNFT 94

  Fly    92 VDFCHYMKH-PNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILV----KDFVLTDTMFAK-I 150
            .|.|..:.: .|||.:|  .:...|||||.||||||.     |||:|    ..||  :..|.| :
  Fly    95 FDGCKMVANVGNPMVLF--LFALFKPYSNINHSCPYT-----HDIIVDKLPTHFV--NQQFTKYV 150

  Fly   151 PLPTGNYMFSIKLATDDVWRVVLNTYF 177
            |||.|:|:|:....|:...|.::..:|
  Fly   151 PLPEGDYVFNSNWFTNGKNRAIVRVHF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 38/92 (41%)
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 38/92 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472141
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.