DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33687

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster


Alignment Length:169 Identity:54/169 - (31%)
Similarity:86/169 - (50%) Gaps:21/169 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ITRH---TNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKLSGYH 84
            :|.|   ||:|||::|::|..|.:|::..:.|......:.:|...|||..|.:.....:..:||.
  Fly     8 LTSHLSFTNLKCEMIDRTFGNFEMCRIKAVNRTHKYIDINLKLYILPINNIMIKLDSKRYTNGYR 72

  Fly    85 PFLFNVTVDFCHYMKHPNPMN------IFHYFYTAVKPYSNFNHSCPYNVSESYHDILVKDF--- 140
            ||..::|.|||.|:|:||..:      |...|..|    ||.||:||||     :||.|..|   
  Fly    73 PFFMSLTFDFCKYLKNPNQRSMIFLKEIHSTFINA----SNLNHTCPYN-----NDITVNKFWTG 128

  Fly   141 VLTDTMFAKIPLPTGNYMFSIKLATDDVWRVVLNTYFDV 179
            .|.......:|:|.|:|.......:.:|.|:::||:|.:
  Fly   129 NLERAFLRYLPVPNGDYAIFSTWYSSNVPRLLVNTFFQI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 32/95 (34%)
CG33687NP_001027130.2 DUF1091 64..147 CDD:284008 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
55.010

Return to query results.
Submit another query.