DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33777

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster


Alignment Length:160 Identity:53/160 - (33%)
Similarity:88/160 - (55%) Gaps:8/160 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKLSGYHPFL 87
            :.:.||:||..||..||....|.|..:.|.....|:.:..|:.|:.:|.||...:|:.:||.|.|
  Fly    17 VEKFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVSRIKVNAATWKRYNGYKPSL 81

  Fly    88 FNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVKDFVLT---DTMFAK 149
            :|.|||.|.::|:|....:.||.|...|.|||.|::||:|     .|.:|:...::   :.:.:.
  Fly    82 YNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFN-----DDAIVEKLPISFVNNQVTSV 141

  Fly   150 IPLPTGNYMFSIKLATDDVWRVVLNTYFDV 179
            :|:|:|:|:||......|:.||.:|.|..:
  Fly   142 LPVPSGDYLFSSHWYFYDIKRVTINVYMTI 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 31/89 (35%)
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 29/83 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472169
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.