DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33798

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster


Alignment Length:180 Identity:58/180 - (32%)
Similarity:96/180 - (53%) Gaps:16/180 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IIIRVFCTITLSLEINGESITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIK 68
            :|..|...:|:.|.....|:...||.:||.||::|::|..|:|..:.|.....|:.:...:.|:.
  Fly     1 MIFSVGFLVTIFLIRKVHSLVEITNFECESLDRNFSDFEYCRLKSVNRTYKYISLKVHLFQTPVN 65

  Fly    69 KISVNFTVYKKLSGYHPFLFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYH 133
            :|.||..:||:|:||.|||:|||||.|.::|:.|...:..:.:...|..:|.||||||:     |
  Fly    66 QIKVNTAIYKRLNGYKPFLYNVTVDGCKFIKNQNSNPVTKFIFGVFKDATNMNHSCPYD-----H 125

  Fly   134 DILVK-------DFVLTDTMFAKIPLPTGNYMFSIKLATDDVWRVVLNTY 176
            ||:::       :|.:|..    :|.|.|.||..:.....|:.|.::..|
  Fly   126 DIIMEKLSAESINFQITKI----LPFPEGKYMVKMNWFAYDINRAIIRLY 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 35/93 (38%)
CG33798NP_001027414.1 DUF1091 69..154 CDD:284008 35/93 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472225
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
87.890

Return to query results.
Submit another query.