DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33922

DIOPT Version :10

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:177 Identity:64/177 - (36%)
Similarity:92/177 - (51%) Gaps:27/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FIIIRVFCTITLSLEINGESITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPI 67
            |.|..|.|.:            ..||:||..||..||.|..|.|..:.|.....|:.:|.||.|:
  Fly    15 FTIHLVICKL------------EFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPV 67

  Fly    68 KKISVNFTVYKKLSGYHPFLFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESY 132
            ..:.:|...:::|:||.|||:|||||.|.:.||.....:|.||:...|.|||.||||||:     
  Fly    68 SNVKINIATFQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYD----- 127

  Fly   133 HDILVKDFVLT--DTMFAKI-PLPTGNYM-------FSIKLATDDVW 169
            |||::....::  :|....: |:|.|||:       ::||.||.||:
  Fly   128 HDIILDKVSISHANTQVTNVLPVPHGNYLYRADWYAYNIKRATVDVY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:461928 37/96 (39%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:461928 36/88 (41%)

Return to query results.
Submit another query.