DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33922

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:177 Identity:64/177 - (36%)
Similarity:92/177 - (51%) Gaps:27/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FIIIRVFCTITLSLEINGESITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPI 67
            |.|..|.|.:            ..||:||..||..||.|..|.|..:.|.....|:.:|.||.|:
  Fly    15 FTIHLVICKL------------EFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPV 67

  Fly    68 KKISVNFTVYKKLSGYHPFLFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESY 132
            ..:.:|...:::|:||.|||:|||||.|.:.||.....:|.||:...|.|||.||||||:     
  Fly    68 SNVKINIATFQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYD----- 127

  Fly   133 HDILVKDFVLT--DTMFAKI-PLPTGNYM-------FSIKLATDDVW 169
            |||::....::  :|....: |:|.|||:       ::||.||.||:
  Fly   128 HDIILDKVSISHANTQVTNVLPVPHGNYLYRADWYAYNIKRATVDVY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 37/96 (39%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 36/88 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472218
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.