DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33927

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:185 Identity:45/185 - (24%)
Similarity:78/185 - (42%) Gaps:34/185 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VFCTITLSLEINGESITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISV 72
            :|..|.|.|.....|..:.||..|:.:::::.....|:|..:.||....|.....|| .|.|..|
  Fly    12 LFFRIALELGSINASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLK-TISKFRV 75

  Fly    73 NFTVYKKLSGYHPFLFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYN---------- 127
            :..::|:.:|:.|:|:|:|.|.|.:::.|....:...| ..:|.:||.|.:|||.          
  Fly    76 HGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVF-NLLKSFSNLNFTCPYMGPVHIMGLHI 139

  Fly   128 VSESYHDILVKDFVLTDTMFAKIPLPTGNYMFSIKLATDDVWRVVLNTYFDVNVE 182
            :.|.                ..:|||||.|:..||      |.:....:....::
  Fly   140 IGEQ----------------IPVPLPTGEYLIQIK------WYISKTLFLSTGIK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 25/96 (26%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472525
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.