DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33654

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster


Alignment Length:161 Identity:51/161 - (31%)
Similarity:80/161 - (49%) Gaps:28/161 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKLSGYHPFLFNVT 91
            ||::|...||||.:|..|.:....|.       .|:|.|     .||.....:.:||.||:||:|
  Fly    29 TNLQCTSFDKSFDDFEYCYIRSANRS-------YKYLTL-----KVNLFKTPRFNGYRPFMFNIT 81

  Fly    92 VDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVK----DFV---LTDTMFAK 149
            :|.|.::|:.:...|..|||.....|||.|||||:|     ||::|.    |||   :|:.    
  Fly    82 LDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFN-----HDLIVDKIPIDFVNHRVTNI---- 137

  Fly   150 IPLPTGNYMFSIKLATDDVWRVVLNTYFDVN 180
            :|.|.|:|:........::.|.::..|:.::
  Fly   138 LPFPEGDYLLETHWIAYEIDRAMVKIYYTIS 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 36/93 (39%)
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 37/100 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472176
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.