DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33689

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster


Alignment Length:160 Identity:58/160 - (36%)
Similarity:83/160 - (51%) Gaps:17/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKLSGYHPFLFNVT 91
            ||:||...|.:||.|..|.:..:.|......||:...||||..|:::|.:.:...||.||..:.|
  Fly    24 TNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDHGYKPFFIDYT 88

  Fly    92 VDFCHYM---KHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVKDFVLT---DTMFAK- 149
            .|.|.::   |||    |...||...:..||.||:|||:     |||:| |.:.|   ::.|.| 
  Fly    89 FDGCKFLRNQKHP----IIKLFYKIYQGSSNINHTCPYD-----HDIIV-DHLWTGNIESDFLKY 143

  Fly   150 IPLPTGNYMFSIKLATDDVWRVVLNTYFDV 179
            ||:..|:|......:||::.|..||.||.|
  Fly   144 IPMINGDYAVYSNWSTDNIMRAYLNLYFRV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 33/93 (35%)
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 32/89 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.