DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33703

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster


Alignment Length:177 Identity:45/177 - (25%)
Similarity:77/177 - (43%) Gaps:6/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRFIIIRVFCTITLSLEINGESITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFL-K 64
            |:..::.:...:.:.|:.:...:.|.:.::|..||.||..|..||:.....|..|..|...|| |
  Fly     1 MKEQLLSLVLPLLIILDCSQGRVFRVSKMECRSLDPSFTYFKTCKVVRRENGRAALYVSEVFLYK 65

  Fly    65 LPIKKISVNFTVYKKLSGYHPFLFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVS 129
            .||..|.:|..|::..........|.|:|:|.:.:.......|.:..|.:...||.|.:||..  
  Fly    66 DPIDDIVLNLGVFRIAKNRRFQFLNETLDYCLFSRQYLASGFFGFLMTPLLRISNLNATCPLQ-- 128

  Fly   130 ESYHDILVKDFVLTDTMFAKIPLPTGNYMFSIKLATDDVWRVVLNTY 176
               .:|....|.:.:....:||:|.|.|||.::.:....||..:..|
  Fly   129 ---QNITFNGFSVDENTIKEIPIPNGVYMFHLRSSLMKKWRTDVKVY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 20/86 (23%)
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 20/86 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.