DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33137

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:140 Identity:32/140 - (22%)
Similarity:62/140 - (44%) Gaps:14/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NVKCEVLDKSFAEFPVCKLNVL--GRGIIAESVYMKFLKLPIKKISVNFTVYKK--LSGYHPFLF 88
            |::|..: ..|:....|.:..:  .:.:....||   |..|:..|::.|.:.||  .:.:.|||.
  Fly    18 NIECSTV-PGFSANASCHIRAINWNKAVAEMDVY---LLRPLYNITIRFQILKKDYSNKFQPFLV 78

  Fly    89 NVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVKDFVLTDTMFAKIPLP 153
            :|.::.|..:...:.:..........:.:|||||||||.     ..::.:...|.::....: .|
  Fly    79 DVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYR-----GHLMARGAYLNESYLPNV-FP 137

  Fly   154 TGNYMFSIKL 163
            .|.|.|:|.:
  Fly   138 LGFYKFNITI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 21/88 (24%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472526
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.840

Return to query results.
Submit another query.