DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG13193

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:92 Identity:21/92 - (22%)
Similarity:39/92 - (42%) Gaps:11/92 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ISVNFTVYKKLSGYHPF--LFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESY 132
            :....|:.:.:.|...:  ||:..:|.|..::.....::...:...|..|.|....||  :..:.
  Fly    76 LRTTITLLQLIDGKDRYQTLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCP--IQPAS 138

  Fly   133 HDILVKDFVLTDTMFAKIP--LPTGNY 157
            :|  |::|.|.:   ..||  ||.|.|
  Fly   139 YD--VRNFQLEN---HSIPGYLPAGFY 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 21/90 (23%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.