DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG12898

DIOPT Version :10

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster


Alignment Length:165 Identity:31/165 - (18%)
Similarity:51/165 - (30%) Gaps:58/165 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NGESITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKLSGY 83
            |.|.|.......|   |..:.|:                    |.|:|..|:...|.|.|.... 
  Fly     7 NIEFILESLETNC---DHDYVEY--------------------FRKVPNTKLLYTFRVVKLAPA- 47

  Fly    84 HPFLFNVTVDF---------------CHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYH 133
              |..::||..               |.::.:|....:|...|         ||..   |:.||.
  Fly    48 --FTIDITVKVVKTQRIFYKMENIKGCDFLNNPLLFKMFGEVY---------NHLV---VNGSYF 98

  Fly   134 DILVKD---FVLTDTMFAKIPL--PTGNYMFSIKL 163
            ...:|.   ::..:...:.||.  |.|.:..|:::
  Fly    99 KCPIKPKVYYLKNEGTVSIIPSIHPPGRFQLSMRV 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:461928 20/106 (19%)
CG12898NP_610581.1 DUF1091 58..129 CDD:461928 14/82 (17%)

Return to query results.
Submit another query.