DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33453

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:134 Identity:51/134 - (38%)
Similarity:73/134 - (54%) Gaps:17/134 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKLSGYHPFLFNVT 91
            |||.||.::||:|.|..|:|....|...:.::...||. |...:|:...:.|:||||.||||:||
  Fly    30 TNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFLH-PTNNVSLRLKMVKRLSGYKPFLFDVT 93

  Fly    92 VDFCHYM-KHPNPMNIFHYFYTAVKPYSNFNHSCPY--NVSESYHDILVKDFVLTDTMFAKIPLP 153
            :|.|.:: |..||  :...||:.:|.||..||:|||  .|...||           |....:|||
  Fly    94 IDACQFLRKRHNP--VIKMFYSFIKDYSTLNHTCPYGLQVVSDYH-----------TAVFPVPLP 145

  Fly   154 TGNY 157
            :|:|
  Fly   146 SGDY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 35/89 (39%)
CG33453NP_995888.1 DUF1091 74..149 CDD:284008 34/87 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472533
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
87.890

Return to query results.
Submit another query.