DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33454

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:179 Identity:60/179 - (33%)
Similarity:89/179 - (49%) Gaps:20/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IIIRVFCTITLSLEINGESITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIK 68
            ||:.||..:.. |..:..::.:.|||.||..|||...|..|:|....|...:..:...||. ||.
  Fly     6 IILGVFVAVVF-LVYSDSAMVKMTNVVCESYDKSLTVFHYCRLKAYSRTKTSLHINATFLH-PIN 68

  Fly    69 KISVNFTVYKKLSGYHPFLFNVTVDFCHYMKHP-NPMNIFHYFYTAVKPYSNFNHSCPYNVSESY 132
            .|||.|.:.|:.:||.||||::|||.|.:::.| ||  :....|..:|..||.||||||..    
  Fly    69 SISVRFQMLKRANGYKPFLFDITVDACQFLRKPNNP--VIKIVYNMIKDASNINHSCPYGT---- 127

  Fly   133 HDILVKDFVLTDTMFAKIPLPTGNYMFSIKLATDDVWRVVLNTYFDVNV 181
              :::.||   ..:...:|.|:|:|:..:....:.      .|.|.|||
  Fly   128 --VVLNDF---HRISLPLPFPSGDYLSRLDFLING------KTKFYVNV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 32/87 (37%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 31/86 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472527
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.