DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33752 and CG33483

DIOPT Version :9

Sequence 1:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:157 Identity:58/157 - (36%)
Similarity:87/157 - (55%) Gaps:17/157 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKLSGYHPF 86
            |:...||:||...||:|.:|..|.|..:.|.....|:.:...|:||.|:.|||::.|:.:||.||
  Fly    73 SLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGYKPF 137

  Fly    87 LFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVKDFVLTDTMFAK-- 149
            |:|:|||.|..::|.....||.:||...|.:||.||:||::     ||::|:. :.|:.|..|  
  Fly   138 LYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFD-----HDLIVEK-LPTNFMNQKVN 196

  Fly   150 --IPLPTGNYMF-------SIKLATDD 167
              |..|.|:|:|       .|..||.|
  Fly   197 GDIKFPHGDYLFHSDWYAYGINRATVD 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 36/90 (40%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 36/90 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472155
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
87.890

Return to query results.
Submit another query.