powered by:
Protein Alignment CG33752 and CG30050
DIOPT Version :9
Sequence 1: | NP_001027409.1 |
Gene: | CG33752 / 3771860 |
FlyBaseID: | FBgn0053752 |
Length: | 185 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_725159.2 |
Gene: | CG30050 / 246417 |
FlyBaseID: | FBgn0050050 |
Length: | 192 |
Species: | Drosophila melanogaster |
Alignment Length: | 65 |
Identity: | 14/65 - (21%) |
Similarity: | 27/65 - (41%) |
Gaps: | 4/65 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 LFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFN-HSCPYNVSE-SYHDILVKDF--VLTDTMF 147
:|::|.|.|..::......:.......:...||.. ..||:...: ...:|.|.|. :||::.|
Fly 91 IFDITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFPKGKFESRNISVTDLPPMLTESEF 155
Fly 148 147
Fly 156 155
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33752 | NP_001027409.1 |
DUF1091 |
72..159 |
CDD:284008 |
14/65 (22%) |
CG30050 | NP_725159.2 |
DM8 |
90..177 |
CDD:214778 |
14/65 (22%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.