DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA84a and CheA87a

DIOPT Version :9

Sequence 1:NP_001027150.1 Gene:CheA84a / 3771856 FlyBaseID:FBgn0261290 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_650280.1 Gene:CheA87a / 41642 FlyBaseID:FBgn0038142 Length:183 Species:Drosophila melanogaster


Alignment Length:177 Identity:44/177 - (24%)
Similarity:81/177 - (45%) Gaps:20/177 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIMLIGKTCALIPRTYETRFISITSNGTNLFDFSQIRFLGRER---MANGTFELKEDLDNESFSV 70
            :|:|.........||:..:.:...:..|:... |::|....|.   ..:|..:|.:.|||: ::|
  Fly    16 IIVLTSNITVQAKRTFRIQKLEKVTEDTSYLR-SRLRIAESEENELKVSGYLDLNQRLDND-WTV 78

  Fly    71 VGETFIDSVGDGEY-KQLPFTAPKQSVCTALKAYWS--YFEPSIKYGVKTDFPAHTHPCPLPKGI 132
            |.:.......||:| |.|.|   :..:|..:|:|:.  ::|...:|   ::.| |...|||||..
  Fly    79 VLKVSRSPDSDGDYEKVLTF---EMQLCDFMKSYYKDIFYERIKEY---SNAP-HPSSCPLPKER 136

  Fly   133 YYIKDVVLKNDNWPVIMPRGYLKAVANLFKNDEYGGSLEIVSQISDL 179
            |.::|..........:|..|:.: :....||:|    .:|:|.:.||
  Fly   137 YVLEDYPFNVKLLKKLMSPGFYR-IKYTLKNEE----TKILSYVLDL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA84aNP_001027150.1 DUF1091 <124..153 CDD:284008 8/28 (29%)
CheA87aNP_650280.1 DM8 91..181 CDD:214778 27/100 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.