DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA84a and CheA56a

DIOPT Version :10

Sequence 1:NP_001027150.1 Gene:CheA84a / 3771856 FlyBaseID:FBgn0261290 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027438.1 Gene:CheA56a / 3772206 FlyBaseID:FBgn0262595 Length:180 Species:Drosophila melanogaster


Alignment Length:160 Identity:48/160 - (30%)
Similarity:78/160 - (48%) Gaps:10/160 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YETRFISI--TSNGTNLFDFSQIRFLGRERMANGTFELKEDLDNESFSVVGETFIDSVGDGEYKQ 86
            ||.||.||  ....|......|:|.|||.||.|||....|||| |:|.|:.|:  .:..:|.:.:
  Fly    25 YEVRFESIDAVKGSTETLFLYQLRLLGRNRMINGTLIFLEDLD-ETFDVLFES--HAFKNGYWVK 86

  Fly    87 LPFTAPKQSVCTALKAYW-SYFEPSIKYGVKTDFP-AHTHPCPLPKGIYYIKDVVLKNDNWPVIM 149
            ....|.....|.....|: |:|   :....:::.| .....||..||.|::|:.|:..::||.|:
  Fly    87 GIVNAAASKPCEFFNRYYISFF---LVKSTESNLPTTGAEMCPFRKGTYFVKNGVVSTEDWPPIV 148

  Fly   150 PRGYLKAVANLFKNDEYGGSLEIVSQISDL 179
            .:|..:...:..||.|..|.:::...|:::
  Fly   149 FKGLNRFTISYLKNGECVGGVQLTISIAEI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA84aNP_001027150.1 DUF1091 <124..155 CDD:461928 11/30 (37%)
CheA56aNP_001027438.1 DUF1091 97..179 CDD:472716 21/85 (25%)

Return to query results.
Submit another query.