DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA84a and CG18539

DIOPT Version :10

Sequence 1:NP_001027150.1 Gene:CheA84a / 3771856 FlyBaseID:FBgn0261290 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611315.3 Gene:CG18539 / 37096 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster


Alignment Length:182 Identity:41/182 - (22%)
Similarity:72/182 - (39%) Gaps:29/182 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFCVLIMLIGKTCALIPRTYETRFISITSNGTN---LFDFSQIRFLGRERMA-NGTFELKEDLDN 65
            ||.:..:||....|  .|.:|...:|:||..::   |...::|..|||...| :.|.:...|:|.
  Fly     8 LFLLATLLIDGCKA--GRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTLDWNYDVDK 70

  Fly    66 ESFSVVGETFIDSVGDGEYKQLPFTAPKQSVCTALKAYWSYFEPSIKYGVKTDFPAHTHPC---- 126
            ::..........|..:.:||.:|::.|||.....|..::           |..|..:...|    
  Fly    71 DTMVEADVHHCSSGDEDDYKMMPWSIPKQPFFEYLNGFY-----------KDAFIKNVGHCSNMV 124

  Fly   127 --------PLPKGIYYIKDVVLKNDNWPVIMPRGYLKAVANLFKNDEYGGSL 170
                    |.|:.:|.:...|...:..|.|.|.|:.|....:....::|.:|
  Fly   125 QFDGDFVPPWPRNVYKLDKCVASGEGLPDIAPEGFYKLEYKMTGQVDWGFTL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA84aNP_001027150.1 DUF1091 <124..155 CDD:461928 9/42 (21%)
CG18539NP_611315.3 DUF1091 85..162 CDD:461928 18/87 (21%)

Return to query results.
Submit another query.