DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA84a and CG18536

DIOPT Version :9

Sequence 1:NP_001027150.1 Gene:CheA84a / 3771856 FlyBaseID:FBgn0261290 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611312.1 Gene:CG18536 / 37093 FlyBaseID:FBgn0034322 Length:191 Species:Drosophila melanogaster


Alignment Length:182 Identity:45/182 - (24%)
Similarity:67/182 - (36%) Gaps:50/182 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFCVLIMLIGKTCALIPRTYETRFISITSNGTNLFDFSQIRFLGR-ERMANGTFELKEDLD---- 64
            :.|:|..|   |.|.....||...::.||:     |.|:::|..: ||:....:.|...|:    
  Fly    15 IVCILFHL---TAASRKWDYEPILLTATSS-----DESKLKFEAKIERLGRSDYGLSAILEWKYD 71

  Fly    65 -NESFSVVGETFIDSVGD-GEYKQLPFTAPKQ------------------SVCTALKAYWSYFEP 109
             ||...|..:.:..:.|| .:||.||:..|||                  ..|:.|..|...|:|
  Fly    72 TNEETMVEAQAYRSNSGDESDYKLLPWAIPKQPFYDYINTYYKDVISKNLGYCSNLPKYEDKFQP 136

  Fly   110 SIKYGVKTDFPAHTHPCPLPKGIYYIKDVVLKNDNWPVIMPRGYLKAVANLF 161
                             |.||..|.:....:..|..|.|.|.|:.|.|...|
  Fly   137 -----------------PWPKNTYKLDKCKIGGDGLPEIAPPGFYKIVFTKF 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA84aNP_001027150.1 DUF1091 <124..153 CDD:284008 8/28 (29%)
CG18536NP_611312.1 DUF1091 89..166 CDD:284008 22/93 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459090
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.