DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA84a and CheA29a

DIOPT Version :9

Sequence 1:NP_001027150.1 Gene:CheA84a / 3771856 FlyBaseID:FBgn0261290 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_788004.1 Gene:CheA29a / 246659 FlyBaseID:FBgn0053194 Length:180 Species:Drosophila melanogaster


Alignment Length:185 Identity:56/185 - (30%)
Similarity:88/185 - (47%) Gaps:29/185 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLIMLIGKTCALIP---RTYETRFISITSNG-----TNLFDFSQIRFLGRERMANGTFELKEDLD 64
            |.::|...:...||   :.:.:||.||  ||     ..||..| :|.:|||||.||:...:.|||
  Fly     8 VFLILWTVSQVYIPCWGKKFISRFESI--NGIEGEKETLFTCS-VRLVGRERMLNGSIMHQVDLD 69

  Fly    65 NESFSVVGETFIDSV--GDGEYKQLPF---TAPKQSVCTALKAYW-SYFEPSIKYGVKTDFPAHT 123
             :||.|    ::|.:  .:||:.|...   |.|    |.....|: .||.|.:|   .::.|...
  Fly    70 -DSFDV----WMDILHFKNGEWAQGNIKVRTKP----CDWFTNYFGKYFLPLVK---DSNLPPIQ 122

  Fly   124 HPCPLPKGIYYIKDVVLKNDNWPVIMPRGYLKAVANLFKNDEYGGSLEIVSQISD 178
            ..|..|||.||::...::..|||.|:.||..:...|..::.:..|.::.|..:.|
  Fly   123 EMCVFPKGEYYLRITKIEPQNWPPILYRGLNQFNINYVRDGKSTGGIQFVIDLED 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA84aNP_001027150.1 DUF1091 <124..153 CDD:284008 11/28 (39%)
CheA29aNP_788004.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I7631
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116828at33392
OrthoFinder 1 1.000 - - FOG0009966
OrthoInspector 1 1.000 - - otm74819
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.