DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG14518

DIOPT Version :10

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:151 Identity:60/151 - (39%)
Similarity:96/151 - (63%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLKTISKFRVHGQIFKRANGFKPWLYN 92
            ||.||.||::.|::|:....|||:|:.|....|:.:..:|..:....|..::.|||||:|||||:
  Fly    25 FKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLHPVHDVIVKARLLKRANGYKPWLYS 89

  Fly    93 ITFDGCRFLRKPYEAPVIIVFNLLKSFSNLNFTCPYMGPVHIMGLHIIGEQIPVPLPTGEYLIQI 157
            ::||||:|:|:...|.:.||:.|.|.:|.:|.||||:|...:...::..|::|.|:||||||:.|
  Fly    90 VSFDGCQFIRRRNNALIRIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKLPTPIPTGEYLLMI 154

  Fly   158 KWYISKTLFLSTGIKFAFEEN 178
            .|..:|....:|.:.|.|.|:
  Fly   155 DWVFNKKPQAATNVYFTFVED 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:461928 37/79 (47%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 37/89 (42%)

Return to query results.
Submit another query.