DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG33632

DIOPT Version :9

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:159 Identity:54/159 - (33%)
Similarity:89/159 - (55%) Gaps:12/159 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLK-TISKFRVHGQIFKRANGFKPW 89
            |..:|||..|:::::.:.....|.|:::.|....:|....:|| .::|.:|...::||.||:||:
  Fly    24 SLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQFGLYKRLNGYKPF 88

  Fly    90 LYNITFDGCRFLRKPYEAPVIIVF-NLLKSFSNLNFTCPYMGPVHI--MGLHIIGEQIP--VPLP 149
            |||:|.||||||:.....|:.:.| ||.|.:||:|.||||...:.:  |..|.|..::.  :|.|
  Fly    89 LYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEMSYHSINYKLTEILPFP 153

  Fly   150 TGEYLIQIKWY---ISKTLFLSTGIKFAF 175
            .|.|.:::.|.   |.:.:   |...|||
  Fly   154 EGNYKLEVHWIAYDIDRAI---TTFYFAF 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 36/84 (43%)
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 36/84 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472551
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.