DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG13589

DIOPT Version :9

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:167 Identity:64/167 - (38%)
Similarity:99/167 - (59%) Gaps:5/167 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FRIALELGSI---NASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLKTISKFRV 75
            |.:::.||.:   .|...|.||.||.|.|::|:.||.|||||..|..|:|:.|.|.::......:
  Fly     8 FVVSVILGFLVCGEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIEPAKNIYL 72

  Fly    76 HGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVFNLLKSFSNLNFTCPYMGPVHIMGLHII 140
            |.::.|:|||:||:|::.|||.|.|:|:..:....||:|::|:.|.:|.||||.|...:...|.|
  Fly    73 HMKMMKKANGYKPFLFDYTFDACEFMRRRNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLSDFHHI 137

  Fly   141 GEQIPVPLPTGEYLIQIKWYISKTLFLSTGIKFAFEE 177
              .:|||||:|:||:.:.|........:|.:.|.|.|
  Fly   138 --DVPVPLPSGDYLLLLDWIFDFKPQFATNVYFTFVE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 34/79 (43%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 33/89 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D108326at33392
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
77.000

Return to query results.
Submit another query.