DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG13561

DIOPT Version :9

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:190 Identity:52/190 - (27%)
Similarity:88/190 - (46%) Gaps:43/190 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGTVSNVLYLVLFFRIALELGSINASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGT 65
            |.|::.:..|...:.| |::..:    .||||..|.|.:|.:..|..|||.|::|....:|....
  Fly     1 MATLTELFLLFGLWHI-LQVQGV----AKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRAN 60

  Fly    66 VLK----TISKFRVHGQIFKRANGFKPWLYNI-TFDGCRFLRKPYEAPVIIVFNLLKSFSNLNFT 125
            :|:    .:|   :..|:.|:|:|:||:|||| ..|.|.:|.|.....:.|:.:...:.:|:| .
  Fly    61 ILRWPKGPVS---MRMQLLKKASGYKPFLYNICQSDVCEYLEKRNHPFINIILSSFGNRTNVN-K 121

  Fly   126 CP---------YMGPVHIMGLHIIGEQIPVPLPTGEY------------LIQIKWYISKT 164
            ||         :..||.::.:        :|||.|:|            |.|:|.|.:.|
  Fly   122 CPIPPEIVLEHFRFPVKVLDM--------MPLPFGDYGLFTTFTFHRSELAQVKVYFTLT 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 26/101 (26%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 26/99 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471947
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.