DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG33640

DIOPT Version :10

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster


Alignment Length:81 Identity:23/81 - (28%)
Similarity:36/81 - (44%) Gaps:6/81 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LYNITFDGCRFLRKPYEAPVI-IVFNLLKSFSNLNFTCPYMGPVHIMGLH---IIGEQIPVPLPT 150
            |||:..:.|..|...|:...| :::|....|.|....|| :.|.....||   |....:|..||.
  Fly    86 LYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCP-LKPNFNYSLHRAYIDEAMLPDLLPE 149

  Fly   151 GEYLIQIKW-YISKTL 165
            ..|.:::.: :.||.|
  Fly   150 CTYRLKMSFKHKSKLL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:461928 20/68 (29%)
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 20/68 (29%)

Return to query results.
Submit another query.