DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG33795

DIOPT Version :9

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:176 Identity:68/176 - (38%)
Similarity:108/176 - (61%) Gaps:1/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VSNVLYLVLFFRIALELGSINAS-RFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVL 67
            :||||.:|:.....|....::.| .:|.||.:|:|.|::|:.:::|||||:.|..|..:||.|:.
  Fly     1 MSNVLKIVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIH 65

  Fly    68 KTISKFRVHGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVFNLLKSFSNLNFTCPYMGPV 132
            ...:...:..:..||.||:|||||....||||||||||:....:::.:.|.|||:|.|||:.|.:
  Fly    66 HPTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKPYDMLTKMIYMVFKPFSNINHTCPFYGDI 130

  Fly   133 HIMGLHIIGEQIPVPLPTGEYLIQIKWYISKTLFLSTGIKFAFEEN 178
            .|.|:::..|...:|.|:|:|::||.|...|.:.:.|.|.:.|.||
  Fly   131 LIRGMYLRTEIKAMPYPSGKYMLQINWSFYKKIQVVTNISYDFIEN 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 35/79 (44%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 35/75 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471886
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.