DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and dls

DIOPT Version :10

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001368948.1 Gene:dls / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster


Alignment Length:164 Identity:45/164 - (27%)
Similarity:74/164 - (45%) Gaps:19/164 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFFRIALELGSINASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLKT-ISKFRV 75
            |..:..|.|..|......|||..|.|.|..:::...||:||:.|....:|....:.:. |...||
  Fly     5 LLVKFLLTLPMICFCHVTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPIVDARV 69

  Fly    76 HGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVFNLLKSFSNLNFTCPYMGPVHI------ 134
            ..|..:..:|:||:||::::|||:|::......|...:...:..:|:|.||||...:.:      
  Fly    70 TIQFRRFDSGYKPFLYDLSYDGCKFMKTQKNVLVKTFYRTFQRNTNINHTCPYDHDLIVDKLFTG 134

  Fly   135 -----MGLHIIGEQIPVPLPTGEYLIQIKWYISK 163
                 .|..||       :|.|:|.|...|..:|
  Fly   135 NLEEEFGRFII-------IPNGDYAIYTDWATNK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:461928 24/90 (27%)
dlsNP_001368948.1 DUF1091 73..153 CDD:461928 22/86 (26%)

Return to query results.
Submit another query.