DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG33679

DIOPT Version :9

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster


Alignment Length:146 Identity:44/146 - (30%)
Similarity:74/146 - (50%) Gaps:11/146 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLK-TISKFRVHGQIFKRANGFKPWLYN 92
            :.||..|:|.:::::...:||||.:.||....:.:..:|| .|::..|....:::.||:.|:|:|
  Fly    20 RLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVVRFITYRKLNGYHPFLFN 84

  Fly    93 ITFDGCRFLRKPYEAPVIIVF-NLLKSFSNLNFTCPYMGPVHIMGLHIIGEQI-PVPLPTGEYLI 155
            ::.:.||.||.|....|...| .....|||:|.||||...::|....:..... .||||.|.|.:
  Fly    85 VSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYNDDIYIRNCTLDDRMFAKVPLPKGSYKL 149

  Fly   156 QIKWYISKTLFLSTGI 171
                    ||.:..|:
  Fly   150 --------TLEMDDGV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 28/81 (35%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 27/78 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472304
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.940

Return to query results.
Submit another query.