DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG33914

DIOPT Version :10

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster


Alignment Length:188 Identity:43/188 - (22%)
Similarity:82/188 - (43%) Gaps:21/188 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GTVSNVLYLVLFFRIALELGSINASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTV 66
            |.:..:|..:||      |..::....:|||..|:|.:.:...|..|.:..:.:...::|....:
  Fly     6 GKLLGLLLCLLF------LTELHGVFMRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAM 64

  Fly    67 LKTI-SKFRVHGQIFKR-------ANGFKPWLYNITFDGCRFLRKPYEAPVIIVFNLLKSFSNLN 123
            ||.: :...::.|:..|       |:.::|:|:.:..|.|||.:..:.....:||..:...:|:|
  Fly    65 LKPMFTNIEIYFQLMTRGSESIHAASNWQPFLHTMKLDLCRFWKNHHNHLARMVFEFIDGHTNMN 129

  Fly   124 FTCPYMGPVHIMGLHIIGEQIP-----VPLPTGEYLIQIKWYISKTLFLSTGIKFAFE 176
            .||||....:|....:...::.     ||:|.|.|.:...|.......:.|  .|.||
  Fly   130 HTCPYTKEKYISIDDLTNTEVSAKIRGVPMPKGFYALFTTWSTENITRVVT--NFYFE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:461928 23/91 (25%)
CG33914NP_001027394.2 DUF1091 88..166 CDD:461928 21/77 (27%)

Return to query results.
Submit another query.