DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG33764

DIOPT Version :9

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster


Alignment Length:159 Identity:54/159 - (33%)
Similarity:86/159 - (54%) Gaps:10/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLYLVLFFRIALELGSINASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLK-TI 70
            |..|:|......|:.|:    .||||..|.|::..:.......||::.|....:|....:|| .:
  Fly     9 VASLILLTYYITEIYSV----VKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKIPV 69

  Fly    71 SKFRVHGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVF-NLLKSFSNLNFTCPYMGPVHI 134
            ||.:|...::||.||:.|:|||::||.||||..|...||.:.| |..|.:||:|.:||:...:.:
  Fly    70 SKVKVRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDIIL 134

  Fly   135 --MGLHIIGEQIP--VPLPTGEYLIQIKW 159
              |..|.|..::.  :|.|.|:|:|::.|
  Fly   135 DKMPYHSINNKVTKILPFPEGKYMIEMHW 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 33/84 (39%)
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 33/84 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.