DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG33627

DIOPT Version :9

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027406.1 Gene:CG33627 / 3772219 FlyBaseID:FBgn0053627 Length:183 Species:Drosophila melanogaster


Alignment Length:187 Identity:40/187 - (21%)
Similarity:81/187 - (43%) Gaps:31/187 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VSNVLYLVLFFRIALELGSINAS-RFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVL 67
            ::..|.::|...:|.:..|..|. :..:..|.| ..|..:::.|:|.:  :....:.:|.....:
  Fly     1 MAQFLLIILLIFLASQSESAKAHLKLMWKTFNC-VTNPDYISEHKCII--VEPEKSAISAELQYI 62

  Fly    68 KTISKFRVHGQIF---KRANGFKPWLYNITFDGCRFLR--KPYEAPVIIVFNLLKSFSNLNFTCP 127
            |.:::|....::|   |.:..|:. :.::..|.|:|.:  ..:....|::....|..|.|.  ||
  Fly    63 KDLAQFNATFKLFMPRKPSRSFQK-VIDVNVDICQFAKGIHGHRFMTIVIKAFGKQGSQLK--CP 124

  Fly   128 YMGPVHIMGLHI-----IGEQIPVPLPTGEYLIQIKW------YISKTLFLSTGIKF 173
                 |..||::     |.|.:|..||..::.|::.:      .|:.||   ||..|
  Fly   125 -----HTKGLYVYPNINIAENLPAFLPETDFKIEMNFLSPAAHVINTTL---TGFLF 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 20/89 (22%)
CG33627NP_001027406.1 DUF1091 71..152 CDD:284008 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.