DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG33648

DIOPT Version :9

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:159 Identity:46/159 - (28%)
Similarity:87/159 - (54%) Gaps:8/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YLVLFFRIALELGSINASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVL-KTISK 72
            :|.|...:.| .|..:.|..:|||..|.|.:.:::....||:|::.|....:|.|..:| ..::.
  Fly     5 HLALMIVVIL-YGINDVSIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTN 68

  Fly    73 FRVHGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVI-IVFNLLKSFSNLNF-TCPYMGPVHI- 134
            ..::..::||.||:||:|||::.|.|||||......|: .:|:|:...||:.. |||:...:.: 
  Fly    69 ATINVALYKRYNGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISVD 133

  Fly   135 -MGLHIIGEQIP--VPLPTGEYLIQIKWY 160
             :..:.:..::.  :|:|.|:||...:|:
  Fly   134 KLTTNFLNNKLTQVLPVPEGDYLFAFRWF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 27/85 (32%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 27/85 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.