DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG33654

DIOPT Version :9

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster


Alignment Length:161 Identity:43/161 - (26%)
Similarity:76/161 - (47%) Gaps:30/161 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLFFRIALELGSINASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLKTISKFRV 75
            ::...:.|.:....:|:|:|||..|.|.::::.....|.:::..|....|:....:.||      
  Fly     9 IVVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKT------ 67

  Fly    76 HGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVF-NLLKSFSNLNFTCPYMGPVHIMGLHI 139
                 .|.||::|:::|||.|.||||:.....|:...| ....|:||||.:||:       ...:
  Fly    68 -----PRFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPF-------NHDL 120

  Fly   140 IGEQIPV-----------PLPTGEYLIQIKW 159
            |.::||:           |.|.|:||::..|
  Fly   121 IVDKIPIDFVNHRVTNILPFPEGDYLLETHW 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 28/91 (31%)
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 30/104 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.