DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG14491

DIOPT Version :10

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster


Alignment Length:106 Identity:34/106 - (32%)
Similarity:54/106 - (50%) Gaps:11/106 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FTNFVCDSVN-ETWLAVHQCRL-KAIRRGTTTLSFNGTV--LKTISKFRVHGQI-FKRANGFKPW 89
            |||..|.|.: |..|::.:|.| |:::|.    |||..:  .|.::||.|:.:| ..|..|....
  Fly     3 FTNCSCSSEDPEGMLSLLKCGLSKSVKRP----SFNIELQFKKPVAKFFVNMRIVLPRRFGDDFT 63

  Fly    90 LYNIT-FDGCRFL-RKPYEAPVIIVFNLLKSFSNLNFTCPY 128
            |:|:: .|||..| .|...|.:.:....:..|||:...||:
  Fly    64 LFNLSGIDGCSLLSNKNQIAFIQLGRKHMDRFSNIPKRCPW 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:461928 17/57 (30%)
CG14491NP_611276.1 DM8 60..150 CDD:214778 13/45 (29%)

Return to query results.
Submit another query.