DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG33137

DIOPT Version :9

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:157 Identity:37/157 - (23%)
Similarity:66/157 - (42%) Gaps:27/157 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLKTISKFRVHGQIFKR--ANGFKPWL 90
            :|..|..|.:| ..:.|...|.::||.........:..:|:.:....:..||.|:  :|.|:|:|
  Fly    14 YKLKNIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKDYSNKFQPFL 77

  Fly    91 YNITFDGCRFLRK----PYEAPVIIVFNLLKSFSNLNFTCPYMGPVHIMGLHIIGEQIPVPLPTG 151
            .::..:.|..|.:    ||.   :|:..:.::|||.|.:|||.|.:...|.::....:|...|.|
  Fly    78 VDVVINMCDALSRRSFIPYG---LIILKIARTFSNFNHSCPYRGHLMARGAYLNESYLPNVFPLG 139

  Fly   152 EYLIQIK-----------------WYI 161
            .|...|.                 ||:
  Fly   140 FYKFNITIMENYITPPSAHVGGIIWYV 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 25/85 (29%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 22/93 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471938
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
43.940

Return to query results.
Submit another query.