DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG12898

DIOPT Version :10

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster


Alignment Length:106 Identity:23/106 - (21%)
Similarity:37/106 - (34%) Gaps:28/106 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 TLSFNGTVLKTISKFRVHGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVFNLLKSFSN-- 121
            |:.....|:||       .:||.:....|         ||.||..|      ::|.:.....|  
  Fly    49 TIDITVKVVKT-------QRIFYKMENIK---------GCDFLNNP------LLFKMFGEVYNHL 91

  Fly   122 -LN---FTCPYMGPVHIMGLHIIGEQIPVPLPTGEYLIQIK 158
             :|   |.||....|:.:........||...|.|.:.:.::
  Fly    92 VVNGSYFKCPIKPKVYYLKNEGTVSIIPSIHPPGRFQLSMR 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:461928 19/85 (22%)
CG12898NP_610581.1 DUF1091 58..129 CDD:461928 21/92 (23%)

Return to query results.
Submit another query.