DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG33454

DIOPT Version :9

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:164 Identity:67/164 - (40%)
Similarity:103/164 - (62%) Gaps:5/164 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VSNVLYLVLFFRIALELGSINASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLK 68
            ::||:.|.:|..:...:.| :::..|.||.||:|.:::....|.|||||..|..|:|..|.|.|.
  Fly     2 LANVIILGVFVAVVFLVYS-DSAMVKMTNVVCESYDKSLTVFHYCRLKAYSRTKTSLHINATFLH 65

  Fly    69 TISKFRVHGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVFNLLKSFSNLNFTCPYMGPVH 133
            .|:...|..|:.|||||:||:|::||.|.|:|||||....:.||:|::|..||:|.:||| |.|.
  Fly    66 PINSISVRFQMLKRANGYKPFLFDITVDACQFLRKPNNPVIKIVYNMIKDASNINHSCPY-GTVV 129

  Fly   134 IMGLHIIGEQIPVPLPTGEYLIQIKWYIS-KTLF 166
            :...|.|  .:|:|.|:|:||.::.:.|: ||.|
  Fly   130 LNDFHRI--SLPLPFPSGDYLSRLDFLINGKTKF 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 38/79 (48%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 37/78 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471902
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.