DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG33467

DIOPT Version :9

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:172 Identity:41/172 - (23%)
Similarity:79/172 - (45%) Gaps:18/172 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLYLVLFFRIALELGSINASR--FKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLKT 69
            ||..:.|      :|.:..|:  :|||...|.. |:..:....|.:|.|...|..::.:..::..
  Fly     7 VLLSICF------IGHMTDSQLVYKFTKVECQG-NQARVKNVSCNVKPINWNTALVNLDCYLIYP 64

  Fly    70 ISKFRVHGQIFKR--ANGFKPWLYNITFDGCRFL-RKPYEAPVIIVFNLLKSFSNLNFTCPYMGP 131
            :....:..|:|.:  :|.:||:|.:.||..|..: ||.:....::|:.|.:.|:|:. :|...|.
  Fly    65 LINPTIRVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-SCHISGQ 128

  Fly   132 VHIMGLHIIGEQIPVPLPTGEYLIQIKWYISKTLFLSTGIKF 173
            :.....::....:| |.|.|:|.|.:.:..|.    ||..:|
  Fly   129 LSARNGYLNSSYVP-PFPHGQYQISVMFSDSN----STNREF 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 22/82 (27%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471929
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.