DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG33475

DIOPT Version :10

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster


Alignment Length:88 Identity:18/88 - (20%)
Similarity:35/88 - (39%) Gaps:11/88 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RVHGQIFKRANGFKPWLYNI-TFDGCRFLRKPYEAPVIIVFNLLKSF--SNLNFTCPYMGPVHIM 135
            |:...:..|.      :||| ....|.||.....:.|..|  :.:.|  ::..|.||....|:.:
  Fly    46 RIQNAVSNRT------IYNIKNLAICNFLNNRLISKVYSV--IYEGFVGNSTVFRCPVQPSVYYL 102

  Fly   136 GLHIIGEQIPVPLPTGEYLIQIK 158
            ...:...::|:....|.:.:.:|
  Fly   103 SNSVREFEVPIFHQPGMFRLYVK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:461928 16/82 (20%)
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 16/77 (21%)

Return to query results.
Submit another query.