DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG33483

DIOPT Version :9

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:145 Identity:51/145 - (35%)
Similarity:73/145 - (50%) Gaps:12/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLKT-ISKFRVHGQIFKRANGFKP 88
            ||..:|||..|.|.::.:.....|.||::.|....||....:.|. |:|.:|:..:.||.||:||
  Fly    72 ASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGYKP 136

  Fly    89 WLYNITFDGCRFLRKPYEAPVIIVF-NLLKSFSNLNFTCPY-------MGPVHIMGLHIIGEQIP 145
            :|||||.|.|:.||.....|:...| .|.|..||:|.|||:       ..|.:.|...:.|:   
  Fly   137 FLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGD--- 198

  Fly   146 VPLPTGEYLIQIKWY 160
            :..|.|:||....||
  Fly   199 IKFPHGDYLFHSDWY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 32/87 (37%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 32/87 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.