DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33927 and CG30050

DIOPT Version :10

Sequence 1:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster


Alignment Length:140 Identity:33/140 - (23%)
Similarity:57/140 - (40%) Gaps:30/140 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NETWLAVHQCRLKAIRRGTTTLSFNGTVLKTISKF------------RVHGQIFKRANGFKPWLY 91
            |..:.|...||:...:..|...|.|  :::.:|.|            :|..|||           
  Fly    41 NPNYFANLYCRIIPPKNRTMEASVN--IMQQLSVFSGSLRVSIPNAKKVITQIF----------- 92

  Fly    92 NITFDGCRFLRKPYEAPVI-IVFNLLKSFSNLN-FTCPY-MGPVHIMGLHIIGEQIPVPLPTGEY 153
            :||||.|:.||:.....:| ::.|.|...||.. :.||: .|......:.:  ..:|..|...|:
  Fly    93 DITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFPKGKFESRNISV--TDLPPMLTESEF 155

  Fly   154 LIQIKWYISK 163
            .:.:.::|.|
  Fly   156 FVNLDFFIPK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33927NP_001027147.1 DUF1091 75..155 CDD:461928 22/82 (27%)
CG30050NP_725159.2 DM8 90..177 CDD:214778 23/89 (26%)

Return to query results.
Submit another query.