DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33768 and CG14518

DIOPT Version :10

Sequence 1:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:161 Identity:39/161 - (24%)
Similarity:65/161 - (40%) Gaps:25/161 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVCVLMVI-------FVSQAVSSSVTLNRVQCEKNAKFF-----ATLNVTSVNST-IYADIEL 53
            :|||.|:.::       :...||...:| |.| ||...|.:     ..|...|.|.. :..|..|
  Fly     1 MKIVLVIWMLAHSLQPPYQCDAVIFKMT-NAV-CETYNKSWVEFGLCRLRAVSRNKVCLNVDANL 63

  Fly    54 LQALKAGFRGHVDVQLRL---SNAKKFQSLVQADTDYCELLSTLKDSLFRRWIKSVSKNSNFMEN 115
            |..:.     .|.|:.||   :|..| ..|.....|.|:.:....::|.|...:...:.|.....
  Fly    64 LHPVH-----DVIVKARLLKRANGYK-PWLYSVSFDGCQFIRRRNNALIRIVWELFKEYSTINHT 122

  Fly   116 CPVPAGHYYLKGWHVEMGLVPSYLLSGDYLL 146
            ||. .|...:|.:::....:|:.:.:|:|||
  Fly   123 CPY-VGLQQVKNFYLRSEKLPTPIPTGEYLL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33768NP_001027142.2 DM8 76..167 CDD:214778 16/71 (23%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 16/72 (22%)

Return to query results.
Submit another query.